PQBP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143271
Article Name: PQBP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143271
Supplier Catalog Number: orb2143271
Alternative Catalog Number: BYT-ORB2143271-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PQBP1
Conjugation: Biotin
Alternative Names: SHS, MRX2, MRX55, MRXS3, MRXS8, NPW38, RENS1
PQBP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
UniProt: O60828
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS