GTF2F2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143334
Article Name: GTF2F2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143334
Supplier Catalog Number: orb2143334
Alternative Catalog Number: BYT-ORB2143334-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GTF2F2
Conjugation: Biotin
Alternative Names: BTF4, RAP30, TF2F2, TFIIF
GTF2F2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 004119
UniProt: P13984
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ