TFAM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143479
Article Name: TFAM Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143479
Supplier Catalog Number: orb2143479
Alternative Catalog Number: BYT-ORB2143479-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
Conjugation: Biotin
Alternative Names: TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15
TFAM Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 003192
UniProt: Q00059
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS