TFAM Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2143484
Article Name: TFAM Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143484
Supplier Catalog Number: orb2143484
Alternative Catalog Number: BYT-ORB2143484-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
Conjugation: FITC
Alternative Names: TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS15
TFAM Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 003192
UniProt: Q00059
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS