MSX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143486
Article Name: MSX2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143486
Supplier Catalog Number: orb2143486
Alternative Catalog Number: BYT-ORB2143486-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human MSX2
Conjugation: Biotin
Alternative Names: FPP, MSH, PFM, CRS2, HOX8, PFM1
MSX2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 002440
UniProt: P35548
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE