NR3C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143931
Article Name: NR3C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143931
Supplier Catalog Number: orb2143931
Alternative Catalog Number: BYT-ORB2143931-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR3C1
Conjugation: Biotin
Alternative Names: GR, GCR, GRL, GCCR, GCRST
NR3C1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 001018086
UniProt: P04150
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAV