CDK4 Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2252868
| Article Name: |
CDK4 Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2252868 |
| Supplier Catalog Number: |
orb2252868 |
| Alternative Catalog Number: |
BYT-ORB2252868-25 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of rat CDK4 |
| Conjugation: |
Unconjugated |
| CDK4 Antibody - middle region |
| Clonality: |
Polyclonal |
| Molecular Weight: |
33 kDa |
| NCBI: |
446045 |
| UniProt: |
P35426 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: SRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDF |
