CD86 Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2252870
| Article Name: |
CD86 Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2252870 |
| Supplier Catalog Number: |
orb2252870 |
| Alternative Catalog Number: |
BYT-ORB2252870-25 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse CD86 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
B7, B70, Ly5, MB7, B7-2, B7.2, CLS1, Ly-5, Ly58, Cd28l, ETC-1, Ly-58, MB7-2, Cd28l2, TS/A-2 |
| CD86 Antibody - middle region |
| Clonality: |
Polyclonal |
| Molecular Weight: |
35 kDa |
| NCBI: |
062261 |
| UniProt: |
P42082 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: TVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVL |
