SELL Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2252871
Article Name: |
SELL Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2252871 |
Supplier Catalog Number: |
orb2252871 |
Alternative Catalog Number: |
BYT-ORB2252871-25 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SELL |
Conjugation: |
Unconjugated |
Alternative Names: |
L, Lya, CD62, Lnhr, Ly-2, Lyam, CD62L, L-sel, LECAM, Ly-22, Ly-m2, Lyam1, Ly-m22, Lyam-1, LECAM-1, AI528707, L-selectin |
SELL Antibody - C-terminal region |
Clonality: |
Polyclonal |
Molecular Weight: |
40 kDa |
NCBI: |
035476 |
UniProt: |
P18337 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: NWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARR |