SELL Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2252871
| Article Name: |
SELL Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2252871 |
| Supplier Catalog Number: |
orb2252871 |
| Alternative Catalog Number: |
BYT-ORB2252871-25 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SELL |
| Conjugation: |
Unconjugated |
| Alternative Names: |
L, Lya, CD62, Lnhr, Ly-2, Lyam, CD62L, L-sel, LECAM, Ly-22, Ly-m2, Lyam1, Ly-m22, Lyam-1, LECAM-1, AI528707, L-selectin |
| SELL Antibody - C-terminal region |
| Clonality: |
Polyclonal |
| Molecular Weight: |
40 kDa |
| NCBI: |
035476 |
| UniProt: |
P18337 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: NWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARR |
