ZNF106 Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2255245
| Article Name: |
ZNF106 Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2255245 |
| Supplier Catalog Number: |
orb2255245 |
| Alternative Catalog Number: |
BYT-ORB2255245-25 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP106 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
SH3BP3, ZFP106, ZNF474 |
| ZNF106 Antibody - N-terminal region |
| Clonality: |
Polyclonal |
| Molecular Weight: |
53 kDa |
| NCBI: |
001271235 |
| UniProt: |
Q0VGA6 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: STNNWNYSGPGDKFQPGRNRNSNCQMEDMTMLWNKKSNKSNKYSHDRYNW |
