CA3 Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2255254
Article Name: |
CA3 Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2255254 |
Supplier Catalog Number: |
orb2255254 |
Alternative Catalog Number: |
BYT-ORB2255254-25 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CA3 |
Conjugation: |
Unconjugated |
Alternative Names: |
Car3, CAIII |
CA3 Antibody - N-terminal region |
Clonality: |
Polyclonal |
Molecular Weight: |
28 kDa |
NCBI: |
005172 |
UniProt: |
P07451 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVS |