Atg12 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2262264
| Article Name: |
Atg12 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2262264 |
| Supplier Catalog Number: |
orb2262264 |
| Alternative Catalog Number: |
BYT-ORB2262264-25 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Rat |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Conjugation: |
Unconjugated |
| Alternative Names: |
Apg12l |
| Atg12 Antibody - C-terminal region |
| Clonality: |
Polyclonal |
| Molecular Weight: |
15kDa |
| NCBI: |
001033584 |
| UniProt: |
Q2TBJ5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG |
