MERTK Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2262266
Article Name: |
MERTK Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2262266 |
Supplier Catalog Number: |
orb2262266 |
Alternative Catalog Number: |
BYT-ORB2262266-25 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK |
Conjugation: |
Unconjugated |
Alternative Names: |
MER, RP38, c-Eyk, c-mer, Tyro12 |
MERTK Antibody - N-terminal region |
Clonality: |
Polyclonal |
Molecular Weight: |
109kDa |
NCBI: |
006334 |
UniProt: |
Q12866 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS |