DAZ1 Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2262404
| Article Name: |
DAZ1 Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2262404 |
| Supplier Catalog Number: |
orb2262404 |
| Alternative Catalog Number: |
BYT-ORB2262404-25 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
DAZ, SPGY |
| DAZ1 Antibody - N-terminal region |
| Clonality: |
Polyclonal |
| Molecular Weight: |
64kDa |
| NCBI: |
004072 |
| UniProt: |
Q9NQZ3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR |
