Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)

Catalog Number: BYT-ORB2280208
Article Name: Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)
Biozol Catalog Number: BYT-ORB2280208
Supplier Catalog Number: orb2280208
Alternative Catalog Number: BYT-ORB2280208-20,BYT-ORB2280208-100,BYT-ORB2280208-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: TL1, VEGI
Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15), partial, Biotinylated (Active)
Molecular Weight: 25.4 kDa
UniProt: O95150
Buffer: Lyophilized powder
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 µg/mL on streptavidin coated plates can bind Anti-TNFSF15 antibody. The EC50 is 0.2732 - 0.6370 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 µg/ml on streptavidin coated plates can bind Anti-TNFSF15 antibody. The EC50 is 0.2732 - 0.6370 ng/mL.