Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)

Catalog Number: BYT-ORB2280215
Article Name: Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)
Biozol Catalog Number: BYT-ORB2280215
Supplier Catalog Number: orb2280215
Alternative Catalog Number: BYT-ORB2280215-20,BYT-ORB2280215-100,BYT-ORB2280215-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Recombinant Human Urokinase-type plasminogen activator(PLAU) (Active)
Molecular Weight: 47.9 kDa
UniProt: P00749
Buffer: Lyophilized powder
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHND
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC). PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug.