Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs

Product Overview

• Article Name: Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs
• Biozol Catalog Number: BYT-ORB2280230
• Supplier Catalog Number: orb2280230
• Alternative Catalog Number: BYT-ORB2280230-20,BYT-ORB2280230-100,BYT-ORB2280230-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: MCT 6,Monocarboxylate transporter 5,MCT 5,Solute carrier family 16 member 5

Product Description

Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs

Product Properties

• Molecular Weight: 56.4 kDa
• UniProt: O15375
• Buffer: Lyophilized powder
• Source: Homo sapiens (Human)
• Purity: The purity information is not available for VLPs proteins.
• Form: Lyophilized powder
• Sequence: MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLP

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Images

Detected by Mouse anti-6*His monoclonal antibody.

The purity of VLPs was greater than 95% as determined by SEC-HPLC