Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial

Product Overview

• Article Name: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial
• Biozol Catalog Number: BYT-ORB2280236
• Supplier Catalog Number: orb2280236
• Alternative Catalog Number: BYT-ORB2280236-20,BYT-ORB2280236-100,BYT-ORB2280236-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Fc-gamma RIII-beta,CD16-I,Fc-gamma RIII,Fc-gamma RIIIb,FcRIII,FcRIIIb,FcR-10,IgG Fc receptor III-1,CD antigen CD16b

Product Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial

Product Properties

• Molecular Weight: 20.8 kDa
• UniProt: O75015
• Buffer: Liquid or Lyophilized powder
• Source: Homo sapiens (Human)
• Purity: Greater than 95% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of FCGR3B was greater than 95% as determined by SEC-HPLC