Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)

Catalog Number: BYT-ORB2280241
Article Name: Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)
Biozol Catalog Number: BYT-ORB2280241
Supplier Catalog Number: orb2280241
Alternative Catalog Number: BYT-ORB2280241-20,BYT-ORB2280241-100,BYT-ORB2280241-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C-C CKR-5,CC-CKR-5,CCR-5,CCR5,CHEMR13,HIV-1 fusion coreceptor,CD antigen CD195
Recombinant Human C-C chemokine receptor type 5 (CCR5)-VLPs (Active)
Molecular Weight: 42.3 kDa
UniProt: P51681
Buffer: Lyophilized powder
Source: Homo sapiens (Human)
Purity: The purity information is not available for VLPs proteins.
Form: Lyophilized powder
Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVL
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 µg/mL can bind Anti-CCR5 recombinant antibody. The EC50 is 1.099-1.287 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)
Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 µg/ml can bind Anti-CCR5 recombinant antibody. The EC50 is 1.099-1.287 ng/mL.The VLPs is negative control.