Human C1QA protein

Catalog Number: BYT-ORB244055
Article Name: Human C1QA protein
Biozol Catalog Number: BYT-ORB244055
Supplier Catalog Number: orb244055
Alternative Catalog Number: BYT-ORB244055-20,BYT-ORB244055-100,BYT-ORB244055-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C1qa, C1QA_HUMAN, Complement C1q subcomponent subunit A, Complement component 1 q subcomponent A chain, Complement component 1 q subcomponent alpha polypeptide, Complement component C1q A chain.
Recombinant human Complement C1q subcomponent subunit A
Molecular Weight: 39.7 kDa
UniProt: P02745
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 23-245aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-Page analysis of Human C1QA protein.