Mouse C1qa protein
Catalog Number:
BYT-ORB244056
- Images (3)
| Article Name: | Mouse C1qa protein |
| Biozol Catalog Number: | BYT-ORB244056 |
| Supplier Catalog Number: | orb244056 |
| Alternative Catalog Number: | BYT-ORB244056-1,BYT-ORB244056-100,BYT-ORB244056-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | C1qa |
| This Mouse C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 39.6 kDa |
| UniProt: | P98086 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Expression region is 23-245aa and His-SUMO-tag protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qa. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qa. |
Product Guarantee and Expert Support
