Mouse Cela2a protein
Catalog Number:
BYT-ORB244103
- Images (3)
| Article Name: | Mouse Cela2a protein |
| Biozol Catalog Number: | BYT-ORB244103 |
| Supplier Catalog Number: | orb244103 |
| Alternative Catalog Number: | BYT-ORB244103-1,BYT-ORB244103-100,BYT-ORB244103-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Cela2a |
| This Mouse Cela2a protein spans the amino acid sequence from region 31-271aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 29.7 kDa |
| UniProt: | P05208 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 31-271aa |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cela2a. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cela2a. |
Product Guarantee and Expert Support
