Human CHRNA1 protein

Catalog Number: BYT-ORB244109
Article Name: Human CHRNA1 protein
Biozol Catalog Number: BYT-ORB244109
Supplier Catalog Number: orb244109
Alternative Catalog Number: BYT-ORB244109-20,BYT-ORB244109-100,BYT-ORB244109-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CHRNA1, ACHRA, CHNRA alpha
This Human CHRNA1 protein spans the amino acid sequence from region 21-255aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.1 kDa
UniProt: P02708
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Expression region is 21-255aa and His-Trx-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRNA1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHRNA1.