Human CRYAB protein

Product Overview

• Article Name: Human CRYAB protein
• Biozol Catalog Number: BYT-ORB244132
• Supplier Catalog Number: orb244132
• Alternative Catalog Number: BYT-ORB244132-1,BYT-ORB244132-100,BYT-ORB244132-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CRYAB

Product Description

This Human CRYAB protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 36.2 kDa
• UniProt: P02511
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-175aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRYAB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CRYAB.