Human CYCS protein

Catalog Number: BYT-ORB244150
Article Name: Human CYCS protein
Biozol Catalog Number: BYT-ORB244150
Supplier Catalog Number: orb244150
Alternative Catalog Number: BYT-ORB244150-20,BYT-ORB244150-100,BYT-ORB244150-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CYCS
This Human CYCS protein spans the amino acid sequence from region 2-105aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.6 kDa
UniProt: P99999
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of GST-tag and expression region is 2-105aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CYCS.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CYCS.