Human FAP protein

Catalog Number: BYT-ORB244197
Article Name: Human FAP protein
Biozol Catalog Number: BYT-ORB244197
Supplier Catalog Number: orb244197
Alternative Catalog Number: BYT-ORB244197-1,BYT-ORB244197-100,BYT-ORB244197-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FAP
This Human FAP protein spans the amino acid sequence from region 26-760aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 112 kDa
UniProt: Q12884
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of GST-tag and expression region is 26-760aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FAP.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FAP.