Mouse Hist1h2bm protein

Catalog Number: BYT-ORB244270
Article Name: Mouse Hist1h2bm protein
Biozol Catalog Number: BYT-ORB244270
Supplier Catalog Number: orb244270
Alternative Catalog Number: BYT-ORB244270-1,BYT-ORB244270-100,BYT-ORB244270-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Hist1h2bm
This Mouse Hist1h2bm protein spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.8 kDa
UniProt: P10854
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 2-126aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Hist1h2bm.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Hist1h2bm.