Mouse Mcl1 protein
Catalog Number:
BYT-ORB244367
- Images (3)
| Article Name: | Mouse Mcl1 protein |
| Biozol Catalog Number: | BYT-ORB244367 |
| Supplier Catalog Number: | orb244367 |
| Alternative Catalog Number: | BYT-ORB244367-20,BYT-ORB244367-100,BYT-ORB244367-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Mcl1 |
| This Mouse Mcl1 protein spans the amino acid sequence from region 1-308aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 48.9 kDa |
| UniProt: | P97287 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFV |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Partial of the full length of 1-331aa of His-SUMO-tag and expression region is 1-308aa |



