Human Cox2 protein
Catalog Number:
BYT-ORB244470
- Images (3)
| Article Name: | Human Cox2 protein |
| Biozol Catalog Number: | BYT-ORB244470 |
| Supplier Catalog Number: | orb244470 |
| Alternative Catalog Number: | BYT-ORB244470-1,BYT-ORB244470-100,BYT-ORB244470-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | COX 2 protein, COX-2 protein, COX2 protein, Cyclooxygenase 2 protein, Cyclooxygenase 2b protein, Cyclooxygenase protein, Cyclooxygenase-2 protein, Cyclooxygenase2 protein, fj02a10 protein, GRIPGHS protein, hCox 2 protein, PGG/HS protein, PGH synthase 2 protein, PGHS 2 protein, PGHS-2 protein, PGHS2 protein, PHS 2 protein, PHS II protein, PHS2 protein, PTGS2 protein, ptgs2a protein, TIS10 protein, TIS10 protein protein, unp1239 protein, CoxII protein, Cox-II protein, Cox-2 protein, Cox2 protein |
| This Human Cox2 protein spans the amino acid sequence from region 18-601aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 70.9 kDa |
| UniProt: | P35354 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFA |
| Application Notes: | Biological Origin: Homo sapiens (Human). Application Notes: Partial of the full length of 18-604aa of His-tag and expression region is 18-601aa |



