Human Cox2 protein

Product Overview

• Article Name: Human Cox2 protein
• Biozol Catalog Number: BYT-ORB244470
• Supplier Catalog Number: orb244470
• Alternative Catalog Number: BYT-ORB244470-1,BYT-ORB244470-100,BYT-ORB244470-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: COX 2 protein, COX-2 protein, COX2 protein, Cyclooxygenase 2 protein, Cyclooxygenase 2b protein, Cyclooxygenase protein, Cyclooxygenase-2 protein, Cyclooxygenase2 protein, fj02a10 protein, GRIPGHS protein, hCox 2 protein, PGG/HS protein, PGH synthase 2 protein, PGHS 2 protein, PGHS-2 protein, PGHS2 protein, PHS 2 protein, PHS II protein, PHS2 protein, PTGS2 protein, ptgs2a protein, TIS10 protein, TIS10 protein protein, unp1239 protein, CoxII protein, Cox-II protein, Cox-2 protein, Cox2 protein

Product Description

This Human Cox2 protein spans the amino acid sequence from region 18-601aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 70.9 kDa
• UniProt: P35354
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial of the full length of 18-604aa of His-tag and expression region is 18-601aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PTGS2.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PTGS2.