Mouse Slc1a2 protein
Catalog Number:
BYT-ORB244544
- Images (3)
| Article Name: | Mouse Slc1a2 protein |
| Biozol Catalog Number: | BYT-ORB244544 |
| Supplier Catalog Number: | orb244544 |
| Alternative Catalog Number: | BYT-ORB244544-20,BYT-ORB244544-100,BYT-ORB244544-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Slc1a2 |
| Recombinant mouse Excitatory amino acid transporter 2 |
| Molecular Weight: | 37.6 kDa |
| UniProt: | P43006 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular domain of GST-tag and expression region is 143-238aa |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Slc1a2. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Slc1a2. |
Product Guarantee and Expert Support
