Mouse Thrombospondin 2 protein

Product Overview

• Article Name: Mouse Thrombospondin 2 protein
• Biozol Catalog Number: BYT-ORB244587
• Supplier Catalog Number: orb244587
• Alternative Catalog Number: BYT-ORB244587-1,BYT-ORB244587-100,BYT-ORB244587-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: THBS2 protien, Thrombospondin-2 protien, TSP2 protien, Thrombospondin2 protien

Product Description

This Mouse Thrombospondin 2 protein spans the amino acid sequence from region 19-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 28.1 kDa
• UniProt: Q03350
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial of the full length of 19-1172aa of His-tag and expression region is 19-232aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Thbs2.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Thbs2.