Human p53 protein

Catalog Number: BYT-ORB244598
Article Name: Human p53 protein
Biozol Catalog Number: BYT-ORB244598
Supplier Catalog Number: orb244598
Alternative Catalog Number: BYT-ORB244598-1,BYT-ORB244598-100,BYT-ORB244598-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: BCC7 protein, FLJ92943 protein, HGNC11998 protein, LFS1 protein, p53 protein, p53 Cellular Tumor Antigen protein, p53 tumor suppressor protein, Phosphoprotein p53 protein, Tp53 protein, TRP53 protein, Tumor protein 53 protein, Tumor protein p53 protein, TP53 protein
This Human p53 protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 59.7 kDa
UniProt: P04637
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII
Target: TP53
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TP53.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TP53.