E.coli lktA protein

Product Overview

• Article Name: E.coli lktA protein
• Biozol Catalog Number: BYT-ORB244658
• Supplier Catalog Number: orb244658
• Alternative Catalog Number: BYT-ORB244658-1,BYT-ORB244658-100,BYT-ORB244658-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: lktA

Product Description

This E.coli lktA protein spans the amino acid sequence from region 715-953aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53 kDa
• UniProt: P0C085
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mannheimia haemolytica (Pasteurella haemolytica)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: IGTSHNDIFKGSKFNDAFNGGDGVDTIDGNDGNDRLFGGKGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGDGNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGERITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDASNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQFARAA

Application Notes

• Application Notes: Biological Origin: Mannheimia haemolytica (Pasteurella haemolytica). Application Notes: Partial of the full length of 1-953aa of GST-tag and expression region is 715-953aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mannheimia haemolytica (Pasteurella haemolytica) lktA.