Human vpx protein

Product Overview

• Article Name: Human vpx protein
• Biozol Catalog Number: BYT-ORB244685
• Supplier Catalog Number: orb244685
• Alternative Catalog Number: BYT-ORB244685-20,BYT-ORB244685-100,BYT-ORB244685-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: vpx

Product Description

This Human vpx protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 17.2 kDa
• UniProt: P18099
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV

Application Notes

• Application Notes: Biological Origin: Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2). Application Notes: Full length of His-tag and expression region is 1-113aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) vpx.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) vpx.