Human L2 protein
Catalog Number:
BYT-ORB244764
- Images (3)
| Article Name: | Human L2 protein |
| Biozol Catalog Number: | BYT-ORB244764 |
| Supplier Catalog Number: | orb244764 |
| Alternative Catalog Number: | BYT-ORB244764-20,BYT-ORB244764-100,BYT-ORB244764-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | L2 |
| This Human L2 protein spans the amino acid sequence from region 1-473aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 66.7 kDa |
| UniProt: | P03107 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Human papillomavirus type 16 |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIAEQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNP |
| Application Notes: | Biological Origin: Human papillomavirus type 16. Application Notes: This is His-SUMO-tag protein |



