E.coli Dicer-like protein

Catalog Number: BYT-ORB244773
Article Name: E.coli Dicer-like protein
Biozol Catalog Number: BYT-ORB244773
Supplier Catalog Number: orb244773
Alternative Catalog Number: BYT-ORB244773-1,BYT-ORB244773-100,BYT-ORB244773-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GL50803_103887, Endoribonuclease Dicer-like, EC 3.1.26.-
This E.coli Dicer-like protein spans the amino acid sequence from region 1-754aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 98.5 kDa
UniProt: A8BQJ3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MHALGHCCTVVTTRGPSHWLLLLDTHLGTLPGFKVSAGRGLPAAEVYFEAGPRVSLSRTDATIVAVYQSILFQLLGPTFPASWTEIGATMPHNEYTFPRFISNPPQFATLAFLPLLSPTSPLDLRALMVTAQLMCDAKRLSDEYTDYSTLSASLHGRMVATPEISWSLYVVLGIDSTQTSLSYFTRANESITYMRYYATAHNIHLRAADLPLVAAVRLDDLKDHQIPAPGSWDDLAPKLRFLPPELCLLLPDEFD
Application Notes: Biological Origin: Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) GL50803_103887.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) GL50803_103887.