E.coli dsdA protein

Catalog Number: BYT-ORB244776
Article Name: E.coli dsdA protein
Biozol Catalog Number: BYT-ORB244776
Supplier Catalog Number: orb244776
Alternative Catalog Number: BYT-ORB244776-1,BYT-ORB244776-100,BYT-ORB244776-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: dsdA
This E.coli dsdA protein spans the amino acid sequence from region 1-440aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 63.3 kDa
UniProt: B4TA53
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Salmonella heidelberg (strain SL476)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MENIQKLIARYPLVEDLVALKETTWFNPGATSLAQGLPYVGLTEQDVNAAHDRLARFAPYLAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTIDGEMLLKKDSHLAISGSIKARGGIYEVLTHAEKLALEAGLLTTDDDYSVLLSPEFKQFFSQYSIAVGSTGNLGLSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPNCFFIDDENSRTLFLGYAVAGQRLKA
Application Notes: Biological Origin: Salmonella heidelberg (strain SL476). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella heidelberg (strain SL476) dsdA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Salmonella heidelberg (strain SL476) dsdA.