Human PZP protein

Catalog Number: BYT-ORB245969
Article Name: Human PZP protein
Biozol Catalog Number: BYT-ORB245969
Supplier Catalog Number: orb245969
Alternative Catalog Number: BYT-ORB245969-20,BYT-ORB245969-100,BYT-ORB245969-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PZP CPAMD6
Recombinant human Pregnancy zone protein
Molecular Weight: 65.3 kDa
UniProt: P20742
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein