Mouse Osteopontin protein

Product Overview

• Article Name: Mouse Osteopontin protein
• Biozol Catalog Number: BYT-ORB246001
• Supplier Catalog Number: orb246001
• Alternative Catalog Number: BYT-ORB246001-1,BYT-ORB246001-100,BYT-ORB246001-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: BNSP protein, Bone sialoprotein 1 protein, BSP I protein, BSPI protein, ETA1 protein, Nephropontin protein, OPN protein, Osteopontin protein, Secreted phosphoprotein 1 protein, SPP 1 protein, SPP-1 protein, SPP1 protein, Uropontin protein

Product Description

This Mouse Osteopontin protein spans the amino acid sequence from region 17-290aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 32.3 kDa
• UniProt: P10923
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPKS

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Spp1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Spp1.