Yeast T7 Helix-destabilizing protein

Product Overview

• Article Name: Yeast T7 Helix-destabilizing protein
• Biozol Catalog Number: BYT-ORB246128
• Supplier Catalog Number: orb246128
• Alternative Catalog Number: BYT-ORB246128-1,BYT-ORB246128-100,BYT-ORB246128-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 2.5

Product Description

This Yeast T7 Helix-destabilizing protein spans the amino acid sequence from region 1-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 25.7 kDa
• UniProt: P03696
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia phage T7 (Bacteriophage T7)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Application Notes

• Application Notes: Biological Origin: Escherichia phage T7 (Bacteriophage T7). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Enterobacteria phage T7 (Bacteriophage T7) 2.5.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Enterobacteria phage T7 (Bacteriophage T7) 2.5.