Yeast lolA protein

Product Overview

• Article Name: Yeast lolA protein
• Biozol Catalog Number: BYT-ORB246132
• Supplier Catalog Number: orb246132
• Alternative Catalog Number: BYT-ORB246132-1,BYT-ORB246132-100,BYT-ORB246132-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: lolA

Product Description

This Yeast lolA protein spans the amino acid sequence from region 22-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 22.3 kDa
• UniProt: A7ZYJ5
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli O9:H4 (strain HS)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Application Notes

• Application Notes: Biological Origin: Escherichia coli O9:H4 (strain HS). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Escherichia coli O9: H4 (strain HS) lolA.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Escherichia coli O9: H4 (strain HS) lolA.