Yeast hly protein
Catalog Number:
BYT-ORB246162
- Images (3)
| Article Name: | Yeast hly protein |
| Biozol Catalog Number: | BYT-ORB246162 |
| Supplier Catalog Number: | orb246162 |
| Alternative Catalog Number: | BYT-ORB246162-1,BYT-ORB246162-100,BYT-ORB246162-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | hly |
| This Yeast hly protein spans the amino acid sequence from region 27-319aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 35.3 kDa |
| UniProt: | Q2G1X0 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Staphylococcus aureus (strain NCTC 8325) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD |
| Application Notes: | Biological Origin: Staphylococcus aureus (strain NCTC 8325). Application Notes: This is His-tag protein |



