Human AP2M1 protein

Catalog Number: BYT-ORB246296
Article Name: Human AP2M1 protein
Biozol Catalog Number: BYT-ORB246296
Supplier Catalog Number: orb246296
Alternative Catalog Number: BYT-ORB246296-1,BYT-ORB246296-100,BYT-ORB246296-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: AP2M1
This Human AP2M1 protein spans the amino acid sequence from region 1-435aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 65.7 kDa
UniProt: Q96CW1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-435aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AP2M1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AP2M1.