E.coli CTSD protein
Catalog Number:
BYT-ORB246318
- Images (3)
| Article Name: | E.coli CTSD protein |
| Biozol Catalog Number: | BYT-ORB246318 |
| Supplier Catalog Number: | orb246318 |
| Alternative Catalog Number: | BYT-ORB246318-1,BYT-ORB246318-100,BYT-ORB246318-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | CTSD |
| This E.coli CTSD protein spans the amino acid sequence from region 65-408aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 53.3 kDa |
| UniProt: | G3I4W7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQG |
| Application Notes: | Biological Origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Application Notes: Partial of His-SUMO-tag and expression region is 65-408aa |



