E.coli CTSD protein

Product Overview

• Article Name: E.coli CTSD protein
• Biozol Catalog Number: BYT-ORB246318
• Supplier Catalog Number: orb246318
• Alternative Catalog Number: BYT-ORB246318-1,BYT-ORB246318-100,BYT-ORB246318-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CTSD

Product Description

This E.coli CTSD protein spans the amino acid sequence from region 65-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53.3 kDa
• UniProt: G3I4W7
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQG

Application Notes

• Application Notes: Biological Origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Application Notes: Partial of His-SUMO-tag and expression region is 65-408aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) CTSD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) CTSD.