E.coli ALTA1 protein

Catalog Number: BYT-ORB246477
Article Name: E.coli ALTA1 protein
Biozol Catalog Number: BYT-ORB246477
Supplier Catalog Number: orb246477
Alternative Catalog Number: BYT-ORB246477-20, BYT-ORB246477-100, BYT-ORB246477-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ALTA1
Recombinant Alternaria alternata (Alternaria rot fungus) (Torula alternata) Major allergen Alt a 1
Molecular Weight: 19.2 kDa
UniProt: P79085
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Alternaria alternata (Alternaria rot fungus) (Torula alternata)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
Application Notes: Full length of His-tag and expression region is 19-157aa