E.coli fbpB protein

Catalog Number: BYT-ORB246482
Article Name: E.coli fbpB protein
Biozol Catalog Number: BYT-ORB246482
Supplier Catalog Number: orb246482
Alternative Catalog Number: BYT-ORB246482-20, BYT-ORB246482-100, BYT-ORB246482-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: fbpB
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B
Molecular Weight: 46.7 kDa
UniProt: P9WQP0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVF
Application Notes: Full length of His-SUMO-tag and expression region is 41-325aa