E.coli vpx protein

Product Overview

• Article Name: E.coli vpx protein
• Biozol Catalog Number: BYT-ORB246493
• Supplier Catalog Number: orb246493
• Alternative Catalog Number: BYT-ORB246493-1,BYT-ORB246493-100,BYT-ORB246493-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: vpx

Product Description

This E.coli vpx protein spans the amino acid sequence from region 1-112aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 28.9 kDa
• UniProt: P19508
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA

Application Notes

• Application Notes: Biological Origin: Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey). Application Notes: Full length of His-SUMO-tag and expression region is 1-112aa

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey) vpx.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey) vpx.