E.coli ompA protein

Product Overview

• Article Name: E.coli ompA protein
• Biozol Catalog Number: BYT-ORB246505
• Supplier Catalog Number: orb246505
• Alternative Catalog Number: BYT-ORB246505-1,BYT-ORB246505-100,BYT-ORB246505-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ompA

Product Description

This E.coli ompA protein spans the amino acid sequence from region 24-389aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 55.3 kDa
• UniProt: P27455
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Chlamydia pneumoniae (Chlamydophila pneumoniae)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: LPVGNPSDPSLLIDGTIWEGAAGDPCDPCATWCDAISLRAGFYGDYVFDRILKVDAPKTFSMGAKPTGSAAANYTTAVDRPNPAYNKHLHDAEWFTNAGFIALNIWDRFDVFCTLGASNGYIRGNSTAFNLVGLFGVKGTTVNANELPNVSLSNGVVELYTDTSFSWSVGARGALWECGCATLGAEFQYAQSKPKVEELNVICNVSQFSVNKPKGYKGVAFPLPTDAGVATATGTKSATINYHEWQVGASLSYRL

Application Notes

• Application Notes: Biological Origin: Chlamydia pneumoniae (Chlamydophila pneumoniae). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chlamydia pneumoniae (Chlamydophila pneumoniae) ompA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Chlamydia pneumoniae (Chlamydophila pneumoniae) ompA.