E.coli P30996 protein

Catalog Number: BYT-ORB246512
Article Name: E.coli P30996 protein
Biozol Catalog Number: BYT-ORB246512
Supplier Catalog Number: orb246512
Alternative Catalog Number: BYT-ORB246512-1,BYT-ORB246512-100,BYT-ORB246512-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: P30996
This E.coli P30996 protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 53.6 kDa
UniProt: P30996
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Clostridium botulinum
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPVAINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTNPSDFDPPASLKNGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGKVLLQEISYAKPYLGNDHTPIDEFSPVTRTTSVNIKLSTNVESSMLLNLLVLGAGPDIFESCCYPVRKLIDPDVVYDPSNYGFGSINIVTFSPEYEYTFNDISGGHNSSTESFIADPAISLAHELIHALHGLYGARGVTYEETIEVKQAPL
Application Notes: Biological Origin: Clostridium botulinum. Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium botulinumbotF.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium botulinumbotF.