E.coli entC3 protein

Catalog Number: BYT-ORB246518
Article Name: E.coli entC3 protein
Biozol Catalog Number: BYT-ORB246518
Supplier Catalog Number: orb246518
Alternative Catalog Number: BYT-ORB246518-1,BYT-ORB246518-100,BYT-ORB246518-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: entC3
This E.coli entC3 protein spans the amino acid sequence from region 28-266aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.6 kDa
UniProt: P0A0L5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusentC3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusentC3.